PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA826G00002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 227aa    MW: 26527.5 Da    PI: 10.237
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA826G00002genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-171964147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed+ l ++v+ +G+++W+ Ia++++ gR++k+c++rw++ 
      AA826G00002 19 RGHWRPAEDDNLRQLVQHYGPKNWNFIAQHLQ-GRSGKSCRLRWYNQ 64
                     899*****************************.************96 PP

2Myb_DNA-binding54.23.2e-1771114146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++++T+eE+e+l++a++  G++ W++Iar ++ gRt++ +k++++ 
      AA826G00002  71 KKPFTEEEEERLLKAHRVQGNR-WASIARLFP-GRTDNAVKNHFHV 114
                      689*******************.*********.**********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.4061469IPR017930Myb domain
SuperFamilySSF466892.17E-2917112IPR009057Homeodomain-like
SMARTSM007173.2E-151867IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-262072IPR009057Homeodomain-like
CDDcd001676.47E-132263No hitNo description
PfamPF139211.8E-172282No hitNo description
SMARTSM007174.0E-1470118IPR001005SANT/Myb domain
PROSITE profilePS5129418.33170120IPR017930Myb domain
CDDcd001676.11E-1073113No hitNo description
Gene3DG3DSA:1.10.10.603.4E-2073118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MEMSRGSNSF DNSKISCHRG HWRPAEDDNL RQLVQHYGPK NWNFIAQHLQ GRSGKSCRLR  60
WYNQLDPNIT KKPFTEEEEE RLLKAHRVQG NRWASIARLF PGRTDNAVKN HFHVIMARRK  120
RERFSTTSSS FINQDWNDIV NPNLTRSKNS SEFGLWRYHK DKSWGLWAYP HEFGSSSTSS  180
PQHESEFEKR RRSKELVSDK NASSGNIDDI DGKKKDVTFI DFLGVGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-34191194104MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-34191194104C-Myb DNA-Binding Domain
1msf_C2e-34191194104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002867181.11e-113AtMYB69
TrEMBLD7M8R21e-113D7M8R2_ARALL; AtMYB69
STRINGfgenesh1_pg.C_scaffold_70006541e-113(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101332036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33450.11e-103myb domain protein 69